Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated RSPO3 Monoclonal antibody

RSPO3 Monoclonal Antibody for IF/ICC

Cat No. CL488-66314
Clone No.1E4F1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC

Protein with TSP type-1 repeat, Protein with TSP type 1 repeat, hRspo3, hPWTSR, CRISTIN1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66314 targets RSPO3 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9899

Product name: Recombinant human RSPO3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 27-272 aa of BC022367

Sequence: GRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH

Predict reactive species
Full Name R-spondin 3 homolog (Xenopus laevis)
Calculated Molecular Weight 272 aa, 31 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC022367
Gene Symbol RSPO3
Gene ID (NCBI) 84870
RRIDAB_2883307
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BXY4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RSPO3, also named as R-spondin-3, is a 272 amino acid protein, which contains 1 TSP type-1 domain and 2 FU (furin-like) repeats. RSPO3 may be a secreted protein and belongs to the R-spondin family. RSPO3 is expressed at higher level in placenta, small intestine, fetal thymus and lymph node. RSPO3 is an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. The four R-spondins (RSPO1-4) and three related leucinerich repeat-containing G-protein coupled receptors, LGR4, LGR5, and LGR6 (LGR4-6), constitute a ligand-receptor system that plays critical roles in development, stem cell survival, and oncogenesis. Ectopic expression of RSPO2/3in mouse mammary epithelial cells led to an increase in invasiveness in vitro and in tumor formation and metastasis in vivo.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RSPO3 antibody CL488-66314Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...