Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RSRC1 Polyclonal antibody

RSRC1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Arginine/serine-rich coiled-coil protein 1, BM 011, BM-011, Serine/Arginine-related protein 53, SRrp53

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RSRC1 in ?

Tested Applications

Positive WB detected inHeLa cells
Positive IHC detected inhuman small intestine tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23826-1-AP targets RSRC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20604

Product name: Recombinant human RSRC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 172-334 aa of BC006982

Sequence: AGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERNEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTEKEIDPTSIPTAIKYQDDNSLAHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA

Predict reactive species
Full Name arginine/serine-rich coiled-coil 1
Calculated Molecular Weight 334 aa, 39 kDa
Observed Molecular Weight 38 kDa, 50 kDa
GenBank Accession NumberBC006982
Gene Symbol RSRC1
Gene ID (NCBI) 51319
RRIDAB_2879329
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ96IZ7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSRC1, also named as SRRP53, is a novel SR-related protein of an apparent molecular mass of 53 kDa (45-53 kDa). It is isolated in a gene trap screen that identifies proteins which localize to the nuclear speckles. RSRC1 plays a rol in pre-mRNA splicing and constitutive.

Protocols

Product Specific Protocols
IF protocol for RSRC1 antibody 23826-1-APDownload protocol
IHC protocol for RSRC1 antibody 23826-1-APDownload protocol
WB protocol for RSRC1 antibody 23826-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The RSRC1 Polyclonal antibody (Cat# 23826-1-AP) has a total of 1 citation. It appears in Molecular Medicine Reports, where it was used in WB and IHC to study RSRC1's role in suppressing gastric cancer cell proliferation and migration through PTEN regulation. The associated research field is oncology, specifically gastric cancer biology.

SpeciesApplicationTitle
humanWB,IHC

Mol Med Rep

RSRC1 suppresses gastric cancer cell proliferation and migration by regulating PTEN expression.

Authors - Shijun Yu
  • KD Validated

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

Based on the available review, a researcher rated this product 5 out of 5 stars after using it for Western Blot at a 1:1000 dilution on B cell lines (lot 00020043). The reviewer reported detecting a strong single band, indicating clear specificity and good performance for their application.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Annabel (Verified Customer) (02-12-2026)

Strong single band detected in B cell lines

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: B Cell lines
Loading...
||
New chat

Able™

正在加载,请稍候...