• Featured Product
  • KD/KO Validated

RSU1 Polyclonal antibody

RSU1 Polyclonal Antibody for WB, IP, ELISA
Cat No. 11207-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Ras suppressor protein 1, RSP 1, RSP1, Rsu 1, RSU1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse placenta tissue, human bladder tissue
Positive IP detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11207-1-AP targets RSU1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1693

Product name: Recombinant human RSU1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-277 aa of BC015644

Sequence: MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR

Predict reactive species
Full Name Ras suppressor protein 1
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC015644
Gene Symbol RSU1
Gene ID (NCBI) 6251
RRIDAB_2180921
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15404
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IP protocol for RSU1 antibody 11207-1-APDownload protocol
WB protocol for RSU1 antibody 11207-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB,IHC

Clin Cancer Res

miR-409-3p/-5p promotes tumorigenesis, epithelial to mesenchymal transition and bone metastasis of human prostate cancer.

Authors - Sajni Josson
humanWB

Oncogene

Stromal fibroblast-derived miR-409 promotes epithelial-to-mesenchymal transition and prostate tumorigenesis.

Authors - S Josson
humanWB

Mol Biol Cell

The roles of two distinct regions of PINCH-1 in the regulation of cell attachment and spreading.

Authors - Ito Satoko S
  • KD Validated

J Biol Chem

Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.

Authors - Koichi Fukuda
Loading...
||
New chat Able
正在加载,请稍候...