RSU1 Polyclonal antibody

• 

  WB analysis of mouse placenta using 11207-1-AP

  mouse placenta tissue were subjected to SDS PAGE followed by western blot with 11207-1-AP (RSU1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human bladder using 11207-1-AP

  human bladder tissue were subjected to SDS PAGE followed by western blot with 11207-1-AP (RSU1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human placenta using 11207-1-AP

  IP result of anti-RSU1 (IP:11207-1-AP, 4ug; Detection:11207-1-AP 1:300) with human placenta tissue lysate 1520ug.

• Featured Product
• KD/KO Validated

RSU1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 11207-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

Ras suppressor protein 1, RSP 1, RSP1, Rsu 1, RSU1

---

Tested Applications

• Positive WB detected in: mouse placenta tissue, human bladder tissue
• Positive IP detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

11207-1-AP targets RSU1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1693

  Product name: Recombinant human RSU1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC015644

  Sequence: MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGLFTLSHITQLVLSHNKLTMVPPNIAELKNLEVLNFFNNQIEELPTQISSLQKLKHLNLGMNRLNTLPRGFGSLPALEVLDLTYNNLSENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKEIGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR

• Full Name: Ras suppressor protein 1
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC015644
• Gene Symbol: RSU1
• Gene ID (NCBI): 6251
• RRID: AB_2180921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15404
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,IHC	Clin Cancer Res; miR-409-3p/-5p promotes tumorigenesis, epithelial to mesenchymal transition and bone metastasis of human prostate cancer.; Authors - Sajni Josson
human	WB	Oncogene; Stromal fibroblast-derived miR-409 promotes epithelial-to-mesenchymal transition and prostate tumorigenesis.; Authors - S Josson
human	WB	Mol Biol Cell; The roles of two distinct regions of PINCH-1 in the regulation of cell attachment and spreading.; Authors - Ito Satoko S ; KD Validated
		J Biol Chem; Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.; Authors - Koichi Fukuda