RTF1 Polyclonal antibody

• 

  WB analysis of MCF-7 using 12170-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 12170-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 12170-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 12170-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12170-1-AP (RTF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 12170-1-AP

  IP result of anti-RTF1 (IP:12170-1-AP, 4ug; Detection:12170-1-AP 1:500) with HeLa cells lysate 2400ug.

• 

  IHC staining of human prostate cancer using 12170-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12170-1-AP (RTF1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 12170-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12170-1-AP (RTF1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RTF1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12170-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

CDG1N, GTL7, KIAA0252, RTF1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HL-60 cells, rat brain tissue, mouse brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IP: See 1 publications below

Product Information

12170-1-AP targets RTF1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2812

  Product name: Recombinant human RTF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-307 aa of BC015052

  Sequence: MKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGN

• Full Name: Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
• Calculated Molecular Weight: 585aa,67 kDa; 710aa,80 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC015052
• Gene Symbol: RTF1
• Gene ID (NCBI): 23168
• RRID: AB_2180931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92541
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Cell; Inherited blood cancer predisposition through altered transcription elongation; Authors - Jiawei Zhao
human	WB	Nat Commun; Cell cycle-resolved chromatin proteomics reveals the extent of mitotic preservation of the genomic regulatory landscape.; Authors - Paul Adrian Ginno
mouse	WB	Cell Death Dis; UBR5 targets tumor suppressor CDC73 proteolytically to promote aggressive breast cancer.; Authors - Gang Xiang
mouse	WB	Mol Cell; ARF alters PAF1 complex integrity to selectively repress oncogenic transcription programs upon p53 loss; Authors - Jinli Wang
human	WB	Nat Commun; Multiple structures of RNA polymerase II isolated from human nuclei by ChIP-CryoEM analysis; Authors - Tomoya Kujirai