RTN3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RTN3 Polyclonal antibody, PBS Only (12055-2-PBS)

• 

  WB analysis using 12055-2-AP (same clone as 12055-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12055-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12055-2-AP (same clone as 12055-2-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12055-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 12055-2-AP (same clone as 12055-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12055-2-AP (RTN3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12055-2-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12055-2-AP (same clone as 12055-2-PBS)

  IP result of anti-RTN3 (IP:12055-2-AP, 4ug; Detection:12055-2-AP 1:400) with HeLa cells lysate 2000ug. This data was developed using the same antibody clone with 12055-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 12055-2-AP (same clone as 12055-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12055-2-AP (RTN3 antibody) at dilution of 1:0 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12055-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 12055-2-AP (same clone as 12055-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 12055-2-AP (RTN3 antibody) at dilution of 1:0 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12055-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 12055-2-AP (same clone as 12055-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using RTN3 antibody (12055-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12055-2-PBS in a different storage buffer formulation.

RTN3 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 12055-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

ASYIP, HAP, Homolog of ASY protein, Neuroendocrine-specific protein-like 2, Neuroendocrine-specific protein-like II

---

Product Information

12055-2-PBS targets RTN3 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2685

  Product name: Recombinant human RTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-236 aa of BC011394

  Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE

• Full Name: reticulon 3
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 24 kDa, 100-113 kDa
• GenBank Accession Number: BC011394
• Gene Symbol: RTN3
• Gene ID (NCBI): 10313
• RRID: AB_2301357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95197
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). Four mammalian reticulons (RTN1-4) exist. Reticulon3 (RTN3) is highly expressed in neurons. RTN3 has been shown to modulate secretory pathway protein trafficking. It is a negative modulator of BACE1 (β-secretase) proteolytic activity. RTN3 may induce caspase-8 cascade and apoptosis and may favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress.