RTN4/NOGO Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RTN4/NOGO Polyclonal antibody (10740-1-AP)

RTN4/NOGO Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10740-1-AP Copied!

Publications (26)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

NOGO, RTN4, ASY, Foocen, KIAA0886

• 

  WB analysis using 10740-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10740-1-AP (RTN4/NOGO antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10740-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10740-1-AP (RTN4/NOGO antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10740-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10740-1-AP (RTN4/NOGO antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10740-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10740-1-AP (RTN4/NOGO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 10740-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10740-1-AP (RTN4/NOGO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10740-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10740-1-AP (RTN4/NOGO antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 10740-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using RTN4/NOGO antibody (10740-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RTN4/NOGO in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse testis tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10740-1-AP targets RTN4/NOGO in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1164

  Product name: Recombinant human RTN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC007109

  Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

• Full Name: reticulon 4
• Calculated Molecular Weight: 130 kDa
• Observed Molecular Weight: 190-210 kDa, 45 kDa, 22-25 kDa
• GenBank Accession Number: BC007109
• Gene Symbol: NOGO
• Gene ID (NCBI): 57142
• RRID: AB_2183598
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQC3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. RTN4 (also known as Neurite outgrowth inhibitor or Nogo) is a myelin-associated neurite growth inhibitory protein. Some isoforms of RTN4 have been described. RTN4A (Nogo-A, runs at ~200 kDa), RTN4B (Nogo-B, 40-55 kDa), and RTN4C (Nogo-C, 22-25 kDa) are three major isoforms (PMID: 31092426; 16469703).

Publications

What published studies show

RTN4/NOGO Polyclonal antibody (Cat# 10740-1-AP) has accumulated 26 citations across high-impact journals including Nature, Cell Metabolism, Cell Research, Autophagy, Neuron, Molecular Cell, Advanced Science, Nature Structural & Molecular Biology, PLoS Pathogens, iScience, Journal of Biological Chemistry, and Molecular Biology of the Cell. Associated research fields encompass endoplasmic reticulum biology, autophagy, lipid homeostasis, neurodegeneration (hereditary spastic paraplegia, Alzheimer's), ferroptosis, viral replication, cardiovascular protection, and neuronal development.

Automatically generated from the 26 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; ER proteins decipher the tubulin code to regulate organelle distribution; Authors - Pengli Zheng
mouse	WB	Cell Metab; Receptor-Mediated ER Export of Lipoproteins Controls Lipid Homeostasis in Mice and Humans.; Authors - Xiao Wang
mouse,human	WB,IF	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng
human	WB	Autophagy; DIPK2A promotes STX17- and VAMP7-mediated autophagosome-lysosome fusion by binding to VAMP7B.; Authors - Xiaoyu Tian
human	WB	Autophagy; SARS-CoV-2 ORF3a induces RETREG1/FAM134B-dependent reticulophagy and triggers sequential ER stress and inflammatory responses during SARS-CoV-2 infection.; Authors - Xiaolin Zhang
mouse	WB	Neuron; Profiling of purified autophagic vesicle degradome in the maturing and aging brain; Authors - Emmanouela Kallergi