CoraLite® Plus 488-conjugated RTN4/NOGO Polyclonal antibody

RTN4/NOGO Polyclonal Antibody for IF/ICC
Cat No. CL488-10740

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

ASY, Foocen, KIAA0886, Nbla00271, Nbla10545, Neurite outgrowth inhibitor, NI220/250, NOGO, NOGO A, Nogo B, Nogo C, Nogo protein, NOGOA, NOGOC, NSP, NSP CL, reticulon 4, Reticulon 5, RTN X, RTN4, RTN4 A, RTN4 B1, RTN4 B2, RTN4 C, SP1507

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10740 targets RTN4/NOGO in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1164

Product name: Recombinant human RTN4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-199 aa of BC007109

Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

Predict reactive species
Full Name reticulon 4
Calculated Molecular Weight 130 kDa
Observed Molecular Weight190-210 kDa, 45 kDa, 22-25 kDa
GenBank Accession NumberBC007109
Gene Symbol NOGO
Gene ID (NCBI) 57142
RRIDAB_3672462
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQC3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. RTN4 (also known as Neurite outgrowth inhibitor or Nogo) is a myelin-associated neurite growth inhibitory protein. Some isoforms of RTN4 have been described. RTN4A (Nogo-A, runs at ~200 kDa), RTN4B (Nogo-B, 40-55 kDa), and RTN4C (Nogo-C, 22-25 kDa) are three major isoforms (PMID: 31092426; 16469703).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RTN4/NOGO antibody CL488-10740Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...