CoraLite® Plus 488-conjugated RTN4/NOGO Polyclonal antibody

• 

  IF Staining of A549 using CL488-10740

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite® Plus 488 RTN4/NOGO antibody (CL488-10740) at dilution of 1:200.

RTN4/NOGO Polyclonal Antibody for IF/ICC

Cat No. CL488-10740

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

ASY, Foocen, KIAA0886, Nbla00271, Nbla10545, Neurite outgrowth inhibitor, NI220/250, NOGO, NOGO A, Nogo B, Nogo C, Nogo protein, NOGOA, NOGOC, NSP, NSP CL, reticulon 4, Reticulon 5, RTN X, RTN4, RTN4 A, RTN4 B1, RTN4 B2, RTN4 C, SP1507

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10740 targets RTN4/NOGO in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1164

  Product name: Recombinant human RTN4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC007109

  Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

• Full Name: reticulon 4
• Calculated Molecular Weight: 130 kDa
• Observed Molecular Weight: 190-210 kDa, 45 kDa, 22-25 kDa
• GenBank Accession Number: BC007109
• Gene Symbol: NOGO
• Gene ID (NCBI): 57142
• RRID: AB_3672462
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQC3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER) (PMID: 18177508). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). They are involved in shaping the tubular endoplasmic reticulum network, membrane trafficking, inhibition of axonal growth, and apoptosis (PMID: 24218324). Four mammalian reticulons (RTN1-4) exist. RTN4 (also known as Neurite outgrowth inhibitor or Nogo) is a myelin-associated neurite growth inhibitory protein. Some isoforms of RTN4 have been described. RTN4A (Nogo-A, runs at ~200 kDa), RTN4B (Nogo-B, 40-55 kDa), and RTN4C (Nogo-C, 22-25 kDa) are three major isoforms (PMID: 31092426; 16469703).