Tested Applications
| Positive WB detected in | C2C12 cells, Daudi cells, HeLa cells, HepG2 cells |
| Positive IP detected in | HeLa cells, mouse brain tissue |
| Positive IHC detected in | rat bladder tissue, human gliomas tissue, human placenta tissue, mouse bladder tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10195-1-AP targets RUVBL2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0253 Product name: Recombinant human RUVBL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-463 aa of BC000428 Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS Predict reactive species |
| Full Name | RuvB-like 2 (E. coli) |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC000428 |
| Gene Symbol | RUVBL2 |
| Gene ID (NCBI) | 10856 |
| RRID | AB_2184679 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y230 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RuvB-like 2 (E. coli) (RUVBL2, synonyms: ECP51, TIP48, CGI-46, TIP49B) is the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that RUVBL2 has both ATPase and DNA helicase activities.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| IHC protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| IP protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| WB protocol for RUVBL2 antibody 10195-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RUVBL1/2 (Pontin/Reptin) antibody (Cat# 10195-1-AP) has 28 citations across journals including Nature Communications, Molecular Cell, Science Advances, EMBO Journal, Journal of Clinical Investigation, Cancer Research, Oncogene, Journal of Cell Biology, Nucleic Acids Research, and eLife. Research fields span mTORC1 signaling, m6A-dependent translation, chaperone biology, RNA processing, DNA repair, ferroptosis, and multiple cancer types (colorectal, liver, gastric, lung, oral, myeloma), as well as rheumatology.
| Species | Application | Title |
|---|---|---|
Cancer Res RUVBL1/2 Blockade Targets YTHDF1 Activity to Suppress m6A-Dependent Oncogenic Translation and Colorectal Tumorigenesis
| ||
Nat Commun Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis | ||
Nat Commun Co-translational determination of quaternary structures in chaperone factories. | ||
Nat Commun Inhibition of the CDK2 and Cyclin A complex leads to autophagic degradation of CDK2 in cancer cells. | ||
Mol Cell Metabolic stress controls mTORC1 lysosomal localization and dimerization by regulating the TTT-RUVBL1/2 complex. | ||
Nucleic Acids Res SECIS-binding protein 2 interacts with the SMN complex and the methylosome for selenoprotein mRNP assembly and translation. |
Reviews
What customers say
The single review for this product reports a 4-star rating from a Western Blot application using H1 human embryonic stem cells at a 1/1000 dilution. The reviewer noted that the antibody "worked well" in their experiments, indicating satisfactory performance for detecting the target in human embryonic stem cell lysates. Overall, the feedback is positive, confirming reliable detection in this cell type.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Deyong (Verified Customer) (03-11-2022) | It worked well in H1 human embryonic stem cells.
|
