RUVBL2 Monoclonal antibody

• 

  WB analysis using 67851-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67851-1-Ig (RUVBL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IHC staining of human lung cancer using 67851-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67851-1-Ig (RUVBL2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 67851-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67851-1-Ig (RUVBL2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67851-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RUVBL2 antibody (67851-1-Ig, Clone: 1A1A4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

RUVBL2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67851-1-Ig

Clone No.1A1A4

Publications(1)

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

48 kDa TBP interacting protein, CGI 46, ECP 51, ECP51, INO80 complex subunit J, INO80J, Repressing pontin 52, REPTIN, Reptin 52, RuvB like 2, RuvB like 2 (E. coli), RUVBL2, RVB2, TAP54 beta, TIH2, TIP48, TIP49B

---

Tested Applications

• Positive WB detected in: A549 cells, A431 cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, Neuro-2a cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

67851-1-Ig targets RUVBL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0253

  Product name: Recombinant human RUVBL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-463 aa of BC000428

  Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

• Full Name: RuvB-like 2 (E. coli)
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC000428
• Gene Symbol: RUVBL2
• Gene ID (NCBI): 10856
• RRID: AB_2918610
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y230
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RUVBL2 belongs to the conserved ATPases associated with various cellular activities (AAA+) protein subfamily, which is characterized by the presence of conserved Walker A and B motifs that are involved in ATP binding and hydrolysis. The AAA+ (ATPases associated with diverse cellular activities) ATPases, RUVBL1 and RUVBL2, were originally isolated as components of transcriptional complexes and shown to function in a number of different cellular processes, including transcriptional regulation, chromatin remodelling and DNA damage responses. (PMID: 31572066, PMID: 31138842)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Commun; Paraventricular hypothalamic RUVBL2 neurons suppress appetite by enhancing excitatory synaptic transmission in distinct neurocircuits; Authors - Mingming Xing