CoraLite® Plus 488-conjugated RUVBL2 Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-67851

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 RUVBL2 antibody (CL488-67851, Clone: 1A1A4 ) at dilution of 1:200.

• 

  FC experiment of HL-60 using CL488-67851

  1X10^6 HL-60 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human RUVBL2 (CL488-67851, Clone:1A1A4) (red), or 0.4 ug Mouse IgG2b Isotype Control (CL488-66360-3, Clone: K11B8C4B5) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

RUVBL2 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67851

Clone No.1A1A4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

RUVB2, ECP-51, EC:3.6.4.12, CGI-46, 48 kDa TBP-interacting protein

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HL-60 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67851 targets RUVBL2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0253

  Product name: Recombinant human RUVBL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-463 aa of BC000428

  Sequence: SQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

• Full Name: RuvB-like 2 (E. coli)
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC000428
• Gene Symbol: RUVBL2
• Gene ID (NCBI): 10856
• RRID: AB_2934575
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y230
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RUVBL2 belongs to the conserved ATPases associated with various cellular activities (AAA+) protein subfamily, which is characterized by the presence of conserved Walker A and B motifs that are involved in ATP binding and hydrolysis. The AAA+ (ATPases associated with diverse cellular activities) ATPases, RUVBL1 and RUVBL2, were originally isolated as components of transcriptional complexes and shown to function in a number of different cellular processes, including transcriptional regulation, chromatin remodelling and DNA damage responses. (PMID: 31572066, PMID: 31138842)