RWDD4A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RWDD4A Polyclonal antibody, PBS Only (32101-1-PBS)

• 

  WB analysis using 32101-1-AP (same clone as 32101-1-PBS)

  5637 cells were subjected to SDS PAGE followed by western blot with 32101-1-AP (RWDD4A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32101-1-PBS in a different storage buffer formulation.

RWDD4A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32101-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

32101-1-PBS targets RWDD4A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36777

  Product name: Recombinant human RWDD4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-188 aa of BC107432

  Sequence: MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAMTYTLFEYAKDNKEQFMENHNPINSATSISNIISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDDE

• Full Name: RWD domain containing 4A
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC107432
• Gene Symbol: RWDD4A
• Gene ID (NCBI): 201965
• RRID: AB_3670191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6NW29
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RWDD4, which is a poorly characterized gene that encodes the protein RWD Domain Containing 4, with an RWD domain being involved in protein-protein interactions (PMID: 27916600). RWDD4 was revealed to be a miR506 target in BCa cells, and the downregulation of RWDD4 was found to suppress BCa cell proliferation, migration and invasion (PMID: 30655740).