RYR2 Polyclonal antibody

• 

  IHC staining of human heart using 27587-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27587-1-AP (RYR2 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 27587-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27587-1-AP (RYR2 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of mouse heart using 27587-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using RYR2 antibody (27587-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse heart using 27587-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using RYR2 antibody (27587-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HEK-293T using 27587-1-AP

  1X10^6 HEK-293T cells were intracellularly stained with 0.4 ug Anti-Human RYR2 (27587-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

RYR2 Polyclonal Antibody for IHC, IF-P, FC (Intra), ELISA

Cat No. 27587-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IHC, IF-P, FC (Intra), ELISA

Synonyms

ARVC2, ARVD2, ryanodine receptor 2 (cardiac), RYR2, VTSIP

---

Tested Applications

• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue
• Positive FC (Intra) detected in: HEK-293T cells
• Positive FC detected in: HEK-293T cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27587-1-AP targets RYR2 in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26296

  Product name: Recombinant human RYR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1311-1410 aa of NM_001035

  Sequence: MAEVFSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVL

• Full Name: ryanodine receptor 2 (cardiac)
• Calculated Molecular Weight: 565 kDa
• GenBank Accession Number: NM_001035
• Gene Symbol: RYR2
• Gene ID (NCBI): 6262
• RRID: AB_2880916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RYR2 belongs to the ryanodine receptor family. RYR2 provides communication between transverse-tubules and sarcoplasmic reticulum. Contraction of cardiac muscle is triggered by release of calcium ions from SR following depolarization of T-tubules. Defects in RYR2 are the cause of familial arrhythmogenic right ventricular dysplasia type 2 (ARVD2) which known as arrhythmogenic right ventricular cardiomyopathy 2 (ARVC2). Defects in RYR2 are the cause of catecholaminergic polymorphic ventricular tachycardia type 1 (CPVT1) which known as stress-induced polymorphic ventricular tachycardia (VTSIP).