RYR2 Polyclonal antibody

RYR2 Polyclonal Antibody for IHC, IF-P, FC (Intra), ELISA
Cat No. 27587-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IHC, IF-P, FC (Intra), ELISA

ARVC2, ARVD2, ryanodine receptor 2 (cardiac), RYR2, VTSIP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive FC (Intra) detected inHEK-293T cells
Positive FC detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27587-1-AP targets RYR2 in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26296

Product name: Recombinant human RYR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1311-1410 aa of NM_001035

Sequence: MAEVFSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVL

Predict reactive species
Full Name ryanodine receptor 2 (cardiac)
Calculated Molecular Weight 565 kDa
GenBank Accession NumberNM_001035
Gene Symbol RYR2
Gene ID (NCBI) 6262
RRIDAB_2880916
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92736
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RYR2 belongs to the ryanodine receptor family. RYR2 provides communication between transverse-tubules and sarcoplasmic reticulum. Contraction of cardiac muscle is triggered by release of calcium ions from SR following depolarization of T-tubules. Defects in RYR2 are the cause of familial arrhythmogenic right ventricular dysplasia type 2 (ARVD2) which known as arrhythmogenic right ventricular cardiomyopathy 2 (ARVC2). Defects in RYR2 are the cause of catecholaminergic polymorphic ventricular tachycardia type 1 (CPVT1) which known as stress-induced polymorphic ventricular tachycardia (VTSIP).

Protocols

Product Specific Protocols
IHC protocol for RYR2 antibody 27587-1-APDownload protocol
IF protocol for RYR2 antibody 27587-1-APDownload protocol
FC protocol for RYR2 antibody 27587-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...