RYR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RYR2 Polyclonal antibody, PBS Only (27587-1-PBS)

• 

  IHC staining of human heart using 27587-1-AP (same clone as 27587-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27587-1-AP (RYR2 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 27587-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 27587-1-AP (same clone as 27587-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 27587-1-AP (RYR2 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 27587-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 27587-1-AP (same clone as 27587-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using RYR2 antibody (27587-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27587-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 27587-1-AP (same clone as 27587-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using RYR2 antibody (27587-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27587-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293T using 27587-1-AP (same clone as 27587-1-PBS)

  1X10^6 HEK-293T cells were intracellularly stained with 0.4 ug Anti-Human RYR2 (27587-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 27587-1-PBS in a different storage buffer formulation.

RYR2 Polyclonal Antibody for IHC, IF-P, FC (Intra), Indirect ELISA

Cat No. 27587-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, FC (Intra), Indirect ELISA

Synonyms

---

Product Information

27587-1-PBS targets RYR2 in IHC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26296

  Product name: Recombinant human RYR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1311-1410 aa of NM_001035

  Sequence: MAEVFSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVL

• Full Name: ryanodine receptor 2 (cardiac)
• Calculated Molecular Weight: 565 kDa
• GenBank Accession Number: NM_001035
• Gene Symbol: RYR2
• Gene ID (NCBI): 6262
• RRID: AB_2880916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92736
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RYR2 belongs to the ryanodine receptor family. RYR2 provides communication between transverse-tubules and sarcoplasmic reticulum. Contraction of cardiac muscle is triggered by release of calcium ions from SR following depolarization of T-tubules. Defects in RYR2 are the cause of familial arrhythmogenic right ventricular dysplasia type 2 (ARVD2) which known as arrhythmogenic right ventricular cardiomyopathy 2 (ARVC2). Defects in RYR2 are the cause of catecholaminergic polymorphic ventricular tachycardia type 1 (CPVT1) which known as stress-induced polymorphic ventricular tachycardia (VTSIP).