Rhodopsin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Rhodopsin Polyclonal antibody, PBS Only (30438-1-PBS)

• 

  IHC staining of mouse eye using 30438-1-AP (same clone as 30438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 30438-1-AP (Rhodopsin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30438-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat eye using 30438-1-AP (same clone as 30438-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat eye tissue slide using 30438-1-AP (Rhodopsin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30438-1-PBS in a different storage buffer formulation.

Rhodopsin Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 30438-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

30438-1-PBS targets Rhodopsin in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30879

  Product name: Recombinant human Rhodopsin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of NM_000539

  Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRT

• Full Name: rhodopsin
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: NM_000539
• Gene Symbol: Rhodopsin
• Gene ID (NCBI): 6010
• RRID: AB_3086314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08100
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.