S100A16 Polyclonal antibody, PBS Only

Name: S100A16 Polyclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 11456-1-PBS-100UG

S100A16 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11456-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

AAG13, Aging-associated gene 13 protein, Protein S100 A16, Protein S100 F, Protein S100-A16

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis using 11456-1-AP (same clone as 11456-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11456-1-AP (S100A16 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A431 using 11456-1-AP (same clone as 11456-1-PBS)
A431 cells were subjected to SDS PAGE followed by western blot with 11456-1-AP (S100A16 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of MCF-7 using 11456-1-AP (same clone as 11456-1-PBS)
MCF-7 cells were subjected to SDS PAGE followed by western blot with 11456-1-AP (S100A16 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse brain using 11456-1-AP (same clone as 11456-1-PBS)
IP result of anti-S100A16 (IP:11456-1-AP, 4ug; Detection:11456-1-AP 1:2000) with mouse brain tissue lysate 1680 ug. This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11456-1-AP (S100A16 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11456-1-AP (S100A16 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11456-1-AP (S100A16 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11456-1-AP (S100A16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11456-1-AP (S100A16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11456-1-AP (S100A16 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human bowen disease using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 11456-1-AP (S100A16 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human bowen disease using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 11456-1-AP (S100A16 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human bowen disease using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 11456-1-AP (S100A16 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11456-1-AP (S100A16 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11456-1-AP (S100A16 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11456-1-AP (S100A16 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 11456-1-AP (same clone as 11456-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 11456-1-AP (S100A16 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of MCF-7 using 11456-1-AP (same clone as 11456-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using S100A16 antibody (11456-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11456-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11456-1-PBS targets S100A16 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2023 Product name: Recombinant human S100A16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC019099 Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS Predict reactive species
Full Name	S100 calcium binding protein A16
Calculated Molecular Weight	103 aa, 12 kDa
Observed Molecular Weight	9-12 kDa
GenBank Accession Number	BC019099
Gene Symbol	S100A16
Gene ID (NCBI)	140576
RRID	AB_2269940
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96FQ6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

S100A16 is a member of the S100 protein family. S100A16 is expressed in a variety of human tissues. S100A16 expression is especially high in tissues rich in epithelial cells. Functionally, S100A16 has been linked to several aspects of tumorigenesis, for example, cell proliferation, differentiation, migration, invasion, and epithelial-mesenchymal transition (EMT).Accordingly, S100A16 has been suggested to have both tumour-promoting and suppressive roles in human cancers. S100A16-mediated cellular functions are suggested to be mediated by the regulation of various signaling pathways/proteins including EMT-related proteins E-cadherin and Vimentin, PI3K-AKT, p53, MMP1-1, MMP-2, MMP-9, JNK/p38, etc. (PMID: 37509106).