S100A3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• S100A3 Polyclonal antibody, PBS Only (12343-1-PBS)

• 

  WB analysis of A2780 using 12343-1-AP (same clone as 12343-1-PBS)

  A2780 cells were subjected to SDS PAGE followed by western blot with 12343-1-AP (S100A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12343-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12343-1-AP (same clone as 12343-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12343-1-AP (S100A3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12343-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skin using 12343-1-AP (same clone as 12343-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 12343-1-AP (S100A3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12343-1-PBS in a different storage buffer formulation.

S100A3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12343-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12343-1-PBS targets S100A3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2995

  Product name: Recombinant human S100A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC012893

  Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

• Full Name: S100 calcium binding protein A3
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 7 kDa, 12 kDa
• GenBank Accession Number: BC012893
• Gene Symbol: S100A3
• Gene ID (NCBI): 6274
• RRID: AB_2183761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P33764
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.