S100A8 Monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP80012-1

  Sandwich ELISA sample test of MP80012-1, S100A8 Hybrid Matched Antibody Pair, PBS Only. 82531-3-PBS was coated to a plate as the capture antibody . 66853-2-PBS was HRP conjugated as the detection antibody.

• 

  Sandwich ELISA standard curve of MP80012-1

  Sandwich ELISA standard curve of MP80012-1, S100A8 Hybrid Matched Antibody Pair, PBS Only. 82531-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg3752. 66853-2-PBS was HRP conjugated as the detection antibody. Range: 1.953-500 ng/mL.

• 

  Cytometric bead array sample test of MP80012-1

  Cytometric bead array sample test of MP80012-1, S100A8 Hybrid Matched Antibody Pair, PBS Only. Capture antibody: 82531-3-PBS. Detection antibody: 66853-2-PBS.

• 

  Cytometric bead array standard curve of MP80012-1

  Cytometric bead array standard curve of MP80012-1, S100A8 Hybrid Matched Antibody Pair, PBS Only. Capture antibody: 82531-3-PBS. Detection antibody: 66853-2-PBS. Standard:Eg3752. Range: 1.563-200 ng/mL.

S100A8 Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 66853-2-PBS

Clone No.1B11F6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

66853-2-PBS targets S100A8 as part of a matched antibody pair:

MP80012-1: 82531-3-PBS capture and 66853-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8517

  Product name: Recombinant human S100A8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-93 aa of BC005928

  Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

• Full Name: S100 calcium binding protein A8
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC005928
• Gene Symbol: S100A8
• Gene ID (NCBI): 6279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05109
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.