S100A8 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82531-3-RR (same clone as 82531-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82531-3-RR (S100A8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82531-3-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 82531-3-RR (same clone as 82531-3-PBS)

  IP result of anti-S100A8 (IP:82531-3-RR, 4ug; Detection:82531-3-RR 1:600) with MCF-7 cells lysate 1400 ug. This data was developed using the same antibody clone with 82531-3-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 82531-3-RR (same clone as 82531-3-PBS)

  IP result of anti-S100A8 (IP:82531-3-RR, 4ug; Detection:82531-3-RR 1:600) with HL-60 cells lysate 1800 ug. This data was developed using the same antibody clone with 82531-3-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 82531-3-RR (same clone as 82531-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using S100A8 antibody (82531-3-RR, Clone: 242970G12 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 82531-3-PBS in a different storage buffer formulation.

S100A8 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 82531-3-PBS

Clone No.242970G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, CFAG

---

Product Information

82531-3-PBS targets S100A8 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3752

  Product name: Recombinant Human S100A8 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-93 aa of BC005928

  Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

• Full Name: S100 calcium binding protein A8
• Calculated Molecular Weight: 93 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC005928
• Gene Symbol: S100A8
• Gene ID (NCBI): 6279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05109
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.