Tested Applications
Positive FC (Intra) detected in | HepG2 cells |
Positive FC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
Flow Cytometry (FC) | FC : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL647-11803 targets S100P in FC (Intra) applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2379 Product name: Recombinant human S100P protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC006819 Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK Predict reactive species |
Full Name | S100 calcium binding protein P |
Calculated Molecular Weight | 95 aa, 11 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC006819 |
Gene Symbol | S100P |
Gene ID (NCBI) | 6286 |
RRID | AB_2934865 |
Conjugate | CoraLite® Plus 647 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P25815 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.
Protocols
Product Specific Protocols | |
---|---|
FC protocol for CL Plus 647 S100P antibody CL647-11803 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |