Tested Applications
| Positive WB detected in | HeLa cells, HuH-7 cells |
| Positive IHC detected in | human pancreas cancer tissue, human bowen disease tissue, human colon cancer tissue, human urothelial carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue, human colon cancer tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:6000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11803-1-AP targets S100P in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2379 Product name: Recombinant human S100P protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC006819 Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK Predict reactive species |
| Full Name | S100 calcium binding protein P |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC006819 |
| Gene Symbol | S100P |
| Gene ID (NCBI) | 6286 |
| RRID | AB_2184577 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25815 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100P antibody 11803-1-AP | Download protocol |
| IHC protocol for S100P antibody 11803-1-AP | Download protocol |
| WB protocol for S100P antibody 11803-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The S100P antibody (Cat# 11803-1-AP) has 10 total citations published in journals including Redox Biology, Advanced Science, Cancer Letters, International Journal of Molecular Sciences, BMC Cancer, Diagnostic Pathology, American Journal of Cancer Research, Proteomics Clinical Applications, Technology in Cancer Research & Treatment, and Experimental & Therapeutic Medicine. Research fields span liver fibrosis, non-small cell lung cancer, colorectal cancer, breast cancer, pancreatic cancer, salivary gland tumors, ovarian cancer, and nasopharyngeal carcinoma.
| Species | Application | Title |
|---|---|---|
Redox Biol Integrated stress response-mediated metabolic reprogramming drives hepatic stellate cell activation and liver fibrosis via the noncanonical EIF3d-ATF4-S100P signaling pathway.
| ||
Adv Sci (Weinh) RBMS1 Coordinates with the m6 A Reader YTHDF1 to Promote NSCLC Metastasis through Stimulating S100P Translation | ||
Cancer Lett Liver metastasis or peritoneal metastasis: single-cell RNA sequencing reveals the organotropism in colorectal cancer is driven by distinct partial-EMT processes | ||
Int J Mol Sci Expression-Based Diagnosis, Treatment Selection, and Drug Development for Breast Cancer | ||
BMC Cancer S100P as a potential biomarker for immunosuppressive microenvironment in pancreatic cancer: a bioinformatics analysis and in vitro study | ||
Diagn Pathol Basal cell adenocarcinoma of the salivary gland: a morphological and immunohistochemical comparison with basal cell adenoma with and without capsular invasion. |
