Cardinal Red™-conjugated S100P Polyclonal antibody

S100P Polyclonal Antibody for FC (Intra)
Cat No. CR-11803

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Migration-inducing gene 9 protein, Protein S100 P, Protein S100-E, Protein S100-P, S100 calcium binding protein P

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CR-11803 targets S100P in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2379

Product name: Recombinant human S100P protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC006819

Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Predict reactive species
Full Name S100 calcium binding protein P
Calculated Molecular Weight 95 aa, 11 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC006819
Gene Symbol S100P
Gene ID (NCBI) 6286
RRIDAB_2934334
Conjugate Cardinal Red™ Fluorescent Dye
Excitation/Emission Maxima Wavelengths592 nm / 611 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25815
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.

Protocols

Product Specific Protocols
FC protocol for Cardinal Red™ S100P antibody CR-11803Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...