S1PR2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP00831-1

  The mean S1PR2 concentration was determined to be 53.98 ng/mL in HeLa cell extract based on a 1.20 mg/mL extract load and 33.91 ng/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP00831-1

  Sandwich ELISA standard curve of MP00831-1, Human S1PR2 Recombinant Matched Antibody Pair - PBS only. 83881-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag15470. 83881-1-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL.

• 

  Cytometric bead array standard curve of MP00831-1

  Cytometric bead array standard curve of MP00831-1, S1PR2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83881-2-PBS. Detection antibody: 83881-1-PBS. Standard: Ag15470. Range: 3.125-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 83881-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83881-2-PBS against Human S1PR2 was performed. The affinity constant is 2.35 nM.

• 

  Affinity and Kinetic Characterization of 83881-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83881-2-RR against Human S1PR2 were performed. The affinity constant is 2.35 nM.

S1PR2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83881-2-PBS

Clone No.241067H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

83881-2-PBS targets S1PR2 as part of a matched antibody pair:

MP00831-1: 83881-2-PBS capture and 83881-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15470

  Product name: Recombinant human S1PR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 283-353 aa of BC069598

  Sequence: LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV

• Full Name: sphingosine-1-phosphate receptor 2
• Calculated Molecular Weight: 353 aa, 39 kDa
• GenBank Accession Number: BC069598
• Gene Symbol: S1PR2
• Gene ID (NCBI): 9294
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95136
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.