SACM1L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SACM1L Polyclonal antibody (13033-1-AP)

• Featured Product
• KD/KO Validated

SACM1L Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13033-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Suppressor of actin mutations 1-like protein, SAC1, Phosphatidylinositol-4-phosphate phosphatase, Phosphatidylinositol-3-phosphatase SAC1, KIAA0851

• 

  WB analysis of human kidney using 13033-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13033-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 13033-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 13033-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 13033-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13033-1-AP (SACM1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 13033-1-AP

  IP result of anti-SACM1L (IP:13033-1-AP, 4ug; Detection:13033-1-AP 1:1000) with mouse kidney tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13033-1-AP (SACM1L antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13033-1-AP (SACM1L antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13033-1-AP (SACM1L Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 13033-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 13033-1-AP (SACM1L Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 13033-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using 13033-1-AP (SACM1L antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SACM1L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human kidney tissue, A549 cells, mouse kidney tissue, mouse lung tissue, human brain tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human brain tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13033-1-AP targets SACM1L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3682

  Product name: Recombinant human SACM1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-500 aa of BC016559

  Sequence: QEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISKVANHMDGFQRHFDSQVIIYGKQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIFKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGFRQDSIDLFLG

• Full Name: SAC1 suppressor of actin mutations 1-like (yeast)
• Calculated Molecular Weight: 587 aa, 67 kDa
• Observed Molecular Weight: 60-67 kDa
• GenBank Accession Number: BC016559
• Gene Symbol: SACM1L
• Gene ID (NCBI): 22908
• RRID: AB_2301284
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NTJ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SACM1L(Suppressor of actin mutations 1-like protein) is also named KIAA0851. It is a phosphoinositide phosphatase that hydrolyzes PtdIns3P and PtdIns4P and has low activity towards PtdIns(3,5)P2.

Publications

What published studies show

The anti-SAC1 antibody (Cat# 13033-1-AP) has 20 citations published in journals including Cell, Immunity, Neuron, Cell Research, Cell Host & Microbe, PNAS, Autophagy, Developmental Cell, Journal of Cell Biology, Cancer Research, and others. Research fields span phosphoinositide lipid metabolism, Golgi-to-endosome trafficking, autophagy, antiviral immunity (STING pathway), neurobiology (AMPA receptor trafficking), cancer biology (breast and lung), macrophage biology, and viral–host interactions.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cell; Nutrient-regulated control of lysosome function by signaling lipid conversion; Authors - Michael Ebner ; KD Validated
human,mouse	WB	Cell Res; Intercellular transfer of activated STING triggered by RAB22A-mediated non-canonical autophagy promotes antitumor immunity; Authors - Ying Gao
human	WB,IF	Immunity; ARMH3-mediated recruitment of PI4KB directs Golgi-to-endosome trafficking and activation of the antiviral effector STING; Authors - Run Fang
	IP	Cell Host Microbe; Global mapping of Salmonella enterica-host protein-protein interactions during infection.; Authors - Philipp Walch
human	WB	Cancer Res; Phosphatidylinositol 4-phosphate in the Golgi apparatus regulates cell-cell adhesion and invasive cell migration in human breast cancer.; Authors - Emi Tokuda ; KD Validated
human	WB	Autophagy; PtdIns4P restriction by hydrolase SAC1 decides specific fusion of autophagosomes with lysosomes.; Authors - Hongjun Zhang ; KD Validated