SAMD4A Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 17387-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17387-1-AP (SAMD4A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 17387-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 17387-1-AP (SAMD4A Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 17387-1-AP

  IP result of anti-SAMD4A (IP:17387-1-AP, 4ug; Detection:17387-1-AP 1:500) with mouse skeletal muscle tissue lysate 2200ug.

• 

  IHC staining of human spleen using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human ovary using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human testis using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 17387-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17387-1-AP (SAMD4A antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

SAMD4A Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17387-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, RIP, ELISA

Synonyms

hSmaug1, KIAA1053, Protein Smaug homolog 1, SAMD4, SAMD4A, Smaug, Smaug 1, Smaug1, SMG, SMGA

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, mouse heart tissue
• Positive IP detected in: mouse skeletal muscle tissue
• Positive IHC detected in: human spleen tissue, human kidney tissue, human lung tissue, human ovary tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IHC: See 1 publications below
• RIP: See 1 publications below

Product Information

17387-1-AP targets SAMD4A in WB, IHC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11273

  Product name: Recombinant human SAMD4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-383 aa of BC021726

  Sequence: LLNPYQAAAWDSICPIHWRLTDIIEGGSLRIPLQELHQMILTPIKAYSSPSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCDGELAVAPLPEGDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKKRLLSWKQQVQKLFRSFPRKTLLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQNLWFANPGGSNSMPSRTHSSVQRTRSLPVHTSPQNMLMFQQPGSQVHSGLCLTDLRGWLSLSGAPSMPALTVPKSSQGEFQLPVTEPDINNRLESLCLSMTEHALGDGVDRTSTI

• Full Name: sterile alpha motif domain containing 4A
• Calculated Molecular Weight: 529 aa, 59 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC021726
• Gene Symbol: SAMD4A
• Gene ID (NCBI): 23034
• RRID: AB_2301339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPU9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Mol Immunol; SAMD4 family members suppress human hepatitis B virus by directly binding to the Smaug recognition region of viral RNA.; Authors - Yuze Wang ; KO Validated
human	WB	Cell Host Microbe; MX2 forms nucleoporin-comprising cytoplasmic biomolecular condensates that lure viral capsids; Authors - George D Moschonas
human	WB	Stem Cell Res Ther; RNA-binding protein SAMD4A targets FGF2 to regulate cardiomyocyte lineage specification from human embryonic stem cells; Authors - Na Yi
human	WB,RIP	Commun Biol; LSM12 promotes the lung squamous cell carcinoma progression through mediating alternative splicing of ARRB1; Authors - Lin Wu
	WB	J Adv Res; SAMD4A inhibits abdominal aortic aneurysm development and VSMC phenotypic transformation through targeting KDM2B; Authors - Qing Chen
human	WB	Elife; YAP/TAZ enhances P-body formation to promote tumorigenesis; Authors - Xia Shen