SAP30BP Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA sample test of MP03025-1

  The mean SAP30BP concentration was determined to be 14.64 ng/mL in K-562 cell extract based on a 1.20 mg/mL extract load, 13.81 ng/mL in Jurkat cell extract based on a 1.20 mg/mL extract load, 9.67 ng/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load, 11.54 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load, 7.34 ng/mL in HuH-7 cell extract based on a 1.20 mg/mL extract load, 10.99 ng/mL in HCT 116 cell extract based on a 1.20 mg/mL extract load and 4.93 ng/mL in BxPC-3 cell extract based on a 2.00 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP03025-1

  Sandwich ELISA standard curve of MP03025-1, Human SAP30BP Recombinant Matched Antibody Pair - PBS only. 87054-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag15051. 87054-3-PBS was HRP conjugated as the detection antibody. Range: 0.313-10 ng/mL.

SAP30BP Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 87054-3-PBS

Clone No.252137E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

HTRG, HTRP, SAP30-binding protein

---

Product Information

87054-3-PBS targets SAP30BP as part of a matched antibody pair:

MP03025-1: 87054-1-PBS capture and 87054-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15051

  Product name: Recombinant human SAP30BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-308 aa of BC007592

  Sequence: MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ

• Full Name: SAP30 binding protein
• Calculated Molecular Weight: 308 aa, 34 kDa
• GenBank Accession Number: BC007592
• Gene Symbol: SAP30BP
• Gene ID (NCBI): 29115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UHR5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.