SBF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SBF1 Polyclonal antibody, PBS Only (33515-1-PBS)

• 

  WB analysis using 33515-1-AP (same clone as 33515-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33515-1-AP (SBF1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33515-1-PBS in a different storage buffer formulation.

SBF1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33515-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Inactive phosphatidylinositol 3-phosphatase 5, MTMR5, Myotubularin-related protein 5, SET-binding factor 1

---

Product Information

33515-1-PBS targets SBF1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38267

  Product name: Recombinant human SBF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1300-1430 aa of CCDS93186.1

  Sequence: AGRDALAPPQANGGPPDPGFLRPQRAALYILGDKAQLKGVRSDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPAAEPSPASFLRSLEDSEWLIQIHKLLQVSVLVVELLDSGSSVLVGLEDGWDITT

• Full Name: SET binding factor 1
• Calculated Molecular Weight: 208kDa，1868aa
• Observed Molecular Weight: 210 kDa, 140 kDa
• GenBank Accession Number: CCDS93186.1
• Gene Symbol: SBF1
• Gene ID (NCBI): 6305
• RRID: AB_3742998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95248
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sbf1, a pseudophosphatase of the myotubularin family, is expressed at high levels in seminiferous tubules of the testis, specifically in Sertoli's cells, spermatogonia, and pachytene spermatocytes, but not in postmeiotic round spermatids. Mice that are nullizygous for Sbf1 exhibit male infertility characterized by azoospermia. Faint bands in some lanes around 150 kDa represent apparent Sbf1 degradation products (PMID: 11994405).