SBK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SBK2 Polyclonal antibody, PBS Only (32117-1-PBS)

• 

  WB analysis using 32117-1-AP (same clone as 32117-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32117-1-AP (SBK2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32117-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 32117-1-AP (same clone as 32117-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using SBK2 antibody (32117-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 32117-1-PBS in a different storage buffer formulation.

SBK2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 32117-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Sugen kinase 69 (SgK069), SH3 domain-binding kinase family member 2, SGK069, Serine/threonine-protein kinase SBK2

---

Product Information

32117-1-PBS targets SBK2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37233

  Product name: Recombinant human SBK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 185-348 aa of NM_001101401

  Sequence: KPENVLVCDPACRRFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLLFCLLTGYFPWDRPLAEADPFYEDFLIWQASGQPRDRPQPWFGLAAAADALLRGLLDPHPRRRSAVIAIREHLGRPWRQREGEAEAVGAVEEEAGQ

• Full Name: SH3-binding domain kinase family, member 2
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001101401
• Gene Symbol: SBK2
• Gene ID (NCBI): 646643
• RRID: AB_3670197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0C263
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SH3 domain binding kinase family member 2 (SBK2, also known as SGK069), is an evolutionarily conserved putative serine/threonine protein kinase that plays a crucial role in cardiomyocyte differentiation, particularly in the formation and maintenance of sarcomeres. It is highly atrium-enriched and is muscle-specific, indicating its specialized function in cardiac muscle cells (PMID: 35587025). SBK2 may be useful for identifying and co-registering tumor borders during surgical resection (PMID: 23730413).