SCD1 Recombinant monoclonal antibody

• 

  WB analysis using 81468-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81468-5-RR (SCD antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 81468-5-RR

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SCD antibody (81468-5-RR, Clone: 241487E12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HepG2 using 81468-5-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug SCD Recombinant antibody (81468-5-RR, Clone:241487E12) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of MCF-7 using 81468-5-RR

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug SCD Recombinant antibody (81468-5-RR, Clone:241487E12) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 81468-5-RR

  Biolayer interferometry (BLl) kinetic assays of 81468-5-RR against Human SCD were performed. The affinity constant is 1.83 nM.

SCD1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 81468-5-RR

Clone No.241487E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

SCD, 241487E12, Acyl CoA desaturase, Acyl-CoA desaturase, Delta(9) desaturase

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: HepG2 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81468-5-RR targets SCD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29156

  Product name: Recombinant human SCD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-72 aa of BC005807

  Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV

• Full Name: stearoyl-CoA desaturase (delta-9-desaturase)
• Calculated Molecular Weight: 355 aa, 41 kDa
• Observed Molecular Weight: 28-42 kDa
• GenBank Accession Number: BC005807
• Gene Symbol: SCD
• Gene ID (NCBI): 6319
• RRID: AB_3670496
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00767
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).