SCF Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SCF Polyclonal antibody, PBS Only (23844-1-PBS)

• 

  WB analysis using 23844-1-AP (same clone as 23844-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23844-1-AP (SCF antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 23844-1-AP (same clone as 23844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23844-1-AP (SCF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 23844-1-AP (same clone as 23844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23844-1-AP (SCF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23844-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 23844-1-AP (same clone as 23844-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using SCF antibody (23844-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23844-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 23844-1-AP (same clone as 23844-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SCF antibody (23844-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23844-1-PBS in a different storage buffer formulation.

SCF Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 23844-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

KITLG, c Kit ligand, c-Kit ligand, KIT ligand, Kitl

---

Product Information

23844-1-PBS targets SCF in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20837

  Product name: Recombinant human SCF protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-273 aa of BC074725

  Sequence: MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV

• Full Name: KIT ligand
• Calculated Molecular Weight: 273 aa, 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC074725
• Gene Symbol: SCF
• Gene ID (NCBI): 4254
• RRID: AB_3669419
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P21583
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Stem cell factor (SCF) is also named as mast cell growth factor (MGF), Kit ligand (Kitl), c-Kit ligand, steel factor and Kitlg. SCF is a pleiotropic cytokine (also as a dimeric molecule) that mediates regulatory effects on inflammation, tissue remodeling, and fibrosis through binding to and activating its receptor tyrosine kinase c-Kit (PMID: 1698553, PMID: 8630386, PMID: 23073628). SCF is the ligand of c-Kit, a member of the RTKs family. Molecular activity of RTKs is a primary stimulus of cell motility, and expression of the SCF/c-Kit axis is associated with cell migration (PMID: 28629522). SCF is a cytokine that synergizes the effects of Epo during erythropoiesis. Stem cell factor plays a well-described role in regulating the survival, proliferation, migration, and differentiation of hematopoietic progenitors, melanocytes, and germ cells (PMID: 36688460). More recent studies have demonstrated SCF expression in dermal and intestinal epithelial cells, and increased SCF expression has been reported in the inflamed mucosa of individuals with IBD and colonitis (PMID: 18200049, PMID: 30157426).