SCGB3A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SCGB3A1 Polyclonal antibody, PBS Only (34191-1-PBS)

SCGB3A1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 34191-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

HIN1, Cytokine HIN-1, High in normal 1, Pneumo secretory protein 2, PNSP2

• 

  IHC staining of human lung using 34191-1-AP (same clone as 34191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 34191-1-AP (SCGB3A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 34191-1-AP (same clone as 34191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 34191-1-AP (SCGB3A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34191-1-PBS in a different storage buffer formulation.

---

Product Information

34191-1-PBS targets SCGB3A1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39031

  Product name: Recombinant human SCGB3A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-104 aa of BC029176

  Sequence: FLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

• Full Name: secretoglobin, family 3A, member 1
• Calculated Molecular Weight: 10 kDa
• GenBank Accession Number: BC029176
• Gene Symbol: SCGB3A1
• Gene ID (NCBI): 92304
• RRID: AB_3743169
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96QR1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCGB3A1, also known as HIN-1 or UGRP2, belongs to the secretoglobin superfamily. This ~10 kDa secreted protein exhibits tumor suppressor activity through growth inhibition and is frequently silenced via promoter hypermethylation in breast, lung, and prostate cancers.( PMID: 30768367; 40691840)