SCLT1 Polyclonal antibody

• 

  WB analysis using 14875-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14875-1-AP (SCLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14875-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14875-1-AP (SCLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14875-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14875-1-AP (SCLT1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human placenta using 14875-1-AP

  IP result of anti-SCLT1 (IP:14875-1-AP, 4ug; Detection:14875-1-AP 1:1000) with human placenta tissue lysate 4000ug.

• 

  IHC staining of human colon cancer using 14875-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14875-1-AP (SCLT1 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 14875-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14875-1-AP (SCLT1 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of hTERT-RPE1 using 14875-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using SCLT1 antibody (14875-1-AP) at dilution of 1:600 and CoraLite® Plus 647-conjugated AffiniPure F(ab, CoraLite® Plus 488 ARL13B antibody (CL488-17711, green), Centrin 1 antibody (12794-1-AP, orange).

• 

  IF Staining of hTERT-RPE1 using 14875-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using SCLT1 antibody (14875-1-AP) at dilution of 1:600 and CoraLite® Plus 647-conjugated AffiniPure F(ab, CEP192 antibody (18832-1-AP, orange), CoraLite® Plus 488 ARL13B antibody (CL488-17711, green).

• 

  IF Staining of hTERT-RPE1 using 14875-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using SCLT1 antibody (14875-1-AP) at dilution of 1:600 and CoraLite® Plus 647-conjugated AffiniPure F(ab, CoraLite® Plus 488 ARL13B antibody (CL488-17711, green), CEP250/CNAP1 antibody (14498-1-AP, orange).

SCLT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14875-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Sodium channel-associated protein 1, SAP1, hCAP 1A, CAP1A

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, COLO 320 cells, rat brain tissue, HeLa cells
• Positive IP detected in: human placenta tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:600-1:2400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IF: See 7 publications below

Product Information

14875-1-AP targets SCLT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6646

  Product name: Recombinant human SCLT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC064428

  Sequence: MAAEIDFLREQNRRLNEDFRRYQMESFSKYSSVQKAVCQGEGDDTFENLVFDQSFLAPLVTEYDKHLGELNGQLKYYQA

• Full Name: sodium channel and clathrin linker 1
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 36 kDa,75-80 kDa
• GenBank Accession Number: BC064428
• Gene Symbol: SCLT1
• Gene ID (NCBI): 132320
• RRID: AB_2183691
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NL6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nat Commun; A stress-induced cilium-to-PML-NB route drives senescence initiation; Authors - Xiaoyu Ma
human	IF	Sci Adv; Ciliopathy protein HYLS1 coordinates the biogenesis and signaling of primary cilia by activating the ciliary lipid kinase PIPKIγ.; Authors - Chuan Chen
human	IF	Nat Commun; TALPID3 and ANKRD26 selectively orchestrate FBF1 localization and cilia gating.; Authors - Hao Yan
human	IF	Nat Commun; Phosphatidylinositol phosphate kinase PIPKIγ and phosphatase INPP5E coordinate initiation of ciliogenesis.; Authors - Qingwen Xu
human	IF	Dev Cell; The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base.; Authors - Tomoharu Kanie
mouse	WB	Dev Cell; ASK1-Mediated Phosphorylation Blocks HDAC6 Ubiquitination and Degradation to Drive the Disassembly of Photoreceptor Connecting Cilia.; Authors - Jie Ran