SCN2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SCN2A Polyclonal antibody, PBS Only (27551-1-PBS)

• 

  WB analysis using 27551-1-AP (same clone as 27551-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27551-1-AP (SCN2A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27551-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27551-1-AP (same clone as 27551-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27551-1-AP (SCN2A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27551-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 27551-1-AP (same clone as 27551-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SCN2A antibody (27551-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27551-1-PBS in a different storage buffer formulation.

SCN2A Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 27551-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

BFIC3, HBA, HBSC II, HBSCI, HBSCII

---

Product Information

27551-1-PBS targets SCN2A in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26022

  Product name: Recombinant human SCN2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 280-335 aa of NM_001040142

  Sequence: MQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDA

• Full Name: sodium channel, voltage-gated, type II, alpha subunit
• Calculated Molecular Weight: 228 kDa
• Observed Molecular Weight: ~250 kDa
• GenBank Accession Number: NM_001040142
• Gene Symbol: SCN2A
• Gene ID (NCBI): 6326
• RRID: AB_3085969
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99250
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The Sodium Channel, Voltage-Gated, Type II, Alpha (SCN2A) gene encodes the neuronal sodium channel NaV1.2. There are two major developmentally regulated splice isoforms of NaV1.2 that use mutually exclusive copies of the fifth coding exon and differ by one amino acid at position 209: Asparagine (Asn/N) vs. Aspartic acid (Asp/D). NaV1.2 is one of several sodium channels involved in initiation and propagation of action potentials in neurons. It's widely expressed throughout the human central nervous system, but not in peripheral tissues. (PMID: 29691040)