SCN2B Polyclonal antibody

• 

  WB analysis using 13612-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13612-1-AP (SCN2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SCN2B Polyclonal Antibody for WB, ELISA

Cat No. 13612-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Sodium channel subunit beta 2, Sodium channel subunit beta-2, UNQ326/PRO386

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13612-1-AP targets SCN2B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4515

  Product name: Recombinant human SCN2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-161 aa of BC036793

  Sequence: SMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVI

• Full Name: sodium channel, voltage-gated, type II, beta
• Calculated Molecular Weight: 215 aa, 24 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC036793
• Gene Symbol: SCN2B
• Gene ID (NCBI): 6327
• RRID: AB_2184040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60939
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.