Tested Applications
| Positive WB detected in | HEK-293 cells, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL750-82959-7 targets SCN3B in WB applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag23201 Product name: Recombinant human SCN3B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-93 aa of BC126265 Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ Predict reactive species |
| Full Name | sodium channel, voltage-gated, type III, beta |
| Calculated Molecular Weight | 25 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC126265 |
| Gene Symbol | SCN3B |
| Gene ID (NCBI) | 55800 |
| RRID | AB_3673752 |
| Conjugate | CoraLite® Plus 750 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NY72 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The sodium channel is a multi-subunit protein complex composed of a single large α-subunit along with smaller additional β-subunits. There are at least three different β-subunit genes, SCN1b, SCN2b, and SCN3b, all of which are expressed widely in excitable tissues. The bands on Western blots for SCN3b (45-50 kDa) were significantly larger than the predicted molecular weight, which is consistent with the protein being glycosylated. The two bands on the Western blot could be due to different levels of glycosylation or alternative spliced isoforms. (PMID: 11744748)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CL Plus 750 SCN3B antibody CL750-82959-7 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

