CoraLite® Plus 750-conjugated SCN3B Recombinant monoclonal antibody

SCN3B Uni-rAb® Recombinant Antibody for WB
Cat No. CL750-82959-7
Clone No.230316B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB

230316B2, HSA243396, KIAA1158, SCNB3, Sodium channel regulatory subunit beta-3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-82959-7 targets SCN3B in WB applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag23201

Product name: Recombinant human SCN3B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-93 aa of BC126265

Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ

Predict reactive species
Full Name sodium channel, voltage-gated, type III, beta
Observed Molecular Weight28 kDa
GenBank Accession NumberBC126265
Gene Symbol SCN3B
Gene ID (NCBI) 55800
RRIDAB_3673752
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NY72
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The sodium channel is a multi-subunit protein complex composed of a single large α-subunit along with smaller additional β-subunits. There are at least three different β-subunit genes, SCN1b, SCN2b, and SCN3b, all of which are expressed widely in excitable tissues. The bands on Western blots for SCN3b (45-50 kDa) were significantly larger than the predicted molecular weight, which is consistent with the protein being glycosylated. The two bands on the Western blot could be due to different levels of glycosylation or alternative spliced isoforms. (PMID: 11744748)

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 SCN3B antibody CL750-82959-7Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...