SDC2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67088-1-Ig (same clone as 67088-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67088-1-Ig (SDC2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67088-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67088-1-Ig (same clone as 67088-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67088-1-Ig (SDC2 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67088-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67088-1-Ig (same clone as 67088-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67088-1-Ig (SDC2 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67088-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67088-1-Ig (same clone as 67088-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67088-1-Ig (SDC2 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67088-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67088-1-Ig (same clone as 67088-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67088-1-Ig (SDC2 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67088-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67088-1-Ig (same clone as 67088-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67088-1-Ig (SDC2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67088-1-PBS in a different storage buffer formulation.

SDC2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67088-1-PBS

Clone No.3A7B2

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

Fibroglycan, HSPG, HSPG1, SDC2, SYND2, syndecan 2

---

Product Information

67088-1-PBS targets SDC2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5739

  Product name: Recombinant human SDC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 20-148 aa of BC049836

  Sequence: SRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAA

• Full Name: syndecan 2
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 19 kDa, 22 and 48 kDa
• GenBank Accession Number: BC049836
• Gene Symbol: SDC2
• Gene ID (NCBI): 6383
• RRID: AB_2882395
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P34741
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer. 67088-1-Ig antibody detects the 19 and 22 kDa SDC2 isoforms as well as the 48 kDa dimeric protein in SDS-PAGE.(PMID: 18803305, 23297089, 30022330, 29945573)