Tested Applications
| Positive WB detected in | L02 cells, HuH-7 cells, HepG2 cells, A549 cells, NCI-H1299 cells, Jurkat cells |
| Positive IHC detected in | human liver cancer tissue, human colon cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67088-1-Ig targets SDC2 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, pig |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5739 Product name: Recombinant human SDC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 20-148 aa of BC049836 Sequence: SRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAA Predict reactive species |
| Full Name | syndecan 2 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 19 kDa, 22 and 48 kDa |
| GenBank Accession Number | BC049836 |
| Gene Symbol | SDC2 |
| Gene ID (NCBI) | 6383 |
| RRID | AB_2882395 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P34741 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer. 67088-1-Ig antibody detects the 19 and 22 kDa SDC2 isoforms as well as the 48 kDa dimeric protein in SDS-PAGE.(PMID: 18803305, 23297089, 30022330, 29945573)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SDC2 antibody 67088-1-Ig | Download protocol |
| WB protocol for SDC2 antibody 67088-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SDC2 Monoclonal antibody (Cat# 67088-1-Ig) has 10 citations across journals including Science Bulletin, Theranostics, Cancer Cell International, Cell Oncology, Journal of Cellular and Molecular Medicine, BMC Endocrine Disorders, Genes, FEBS Open Bio, and Heart Vessels. Research fields span liver development, colon cancer, glioma, thyroid cancer, cervical cancer, glioblastoma, heart failure, and cerebral atherosclerosis. Applications include WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
Theranostics Identification of programmed cell death-related subtypes reveals immune heterogeneity and therapeutic divergence in colon cancer. | ||
Cancer Cell Int GNG5 is a novel oncogene associated with cell migration, proliferation, and poor prognosis in glioma. | ||
Cancer Cell Int Identification of an immune-related signature indicating the dedifferentiation of thyroid cells. | ||
Cell Oncol (Dordr) Circular RNA circNFATC3 acts as a miR-9-5p sponge to promote cervical cancer development by upregulating SDC2. | ||
J Cell Mol Med miR-218 affects the ECM composition and cell biomechanical properties of glioblastoma cells. |
