CoraLite® Plus 488-conjugated SDCCAG3 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-15969

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 SDCCAG3 antibody (CL488-15969) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

SDCCAG3 Polyclonal Antibody for IF/ICC

Cat No. CL488-15969

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Antigen NY CO 3, Endosome-associated-trafficking regulator 1, ENTR1, NY CO 3, SDCCAG3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15969 targets SDCCAG3 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8745

  Product name: Recombinant human SDCCAG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-412 aa of BC014515

  Sequence: LGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDGEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCSTYLSFFSTPSELAGPESLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEIKDEEEDS

• Full Name: serologically defined colon cancer antigen 3
• Calculated Molecular Weight: 412 aa, 46 kDa
• Observed Molecular Weight: 48-60 kDa
• GenBank Accession Number: BC014515
• Gene Symbol: SDCCAG3
• Gene ID (NCBI): 10807
• RRID: AB_3672643
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96C92
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SDCCAG3, also named as NY-CO-3, is identified as serologically defined colon cancer antigen-3. It is an endosomal protein which is involved in the regulation of cytokinesis. SDCCAG3 is involved in modulation of TNF response. This gene has four isoforms with MW 40-50 kDa. Observed MW this protein is 48-60 kDa may due to phosphorylation.