SDF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SDF2 Polyclonal antibody, PBS Only (14747-1-PBS)

• 

  WB analysis using 14747-1-AP (same clone as 14747-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14747-1-AP (SDF2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14747-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14747-1-AP (same clone as 14747-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14747-1-AP (SDF2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14747-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 14747-1-AP (same clone as 14747-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 14747-1-AP (SDF2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14747-1-PBS in a different storage buffer formulation.

SDF2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14747-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Stromal cell-derived factor 2, stromal cell derived factor 2, SDF-2

---

Product Information

14747-1-PBS targets SDF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6480

  Product name: Recombinant human SDF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-211 aa of BC000500

  Sequence: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL

• Full Name: stromal cell-derived factor 2
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC000500
• Gene Symbol: SDF2
• Gene ID (NCBI): 6388
• RRID: AB_2918037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99470
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SDF-2 is a small protein of 211 amino acids that is ubiquitously expressed in lung, breast, colon, liver and kidney. SDF-2 is localized in the ER and has been reported to get involved in multiple endoplasmic reticulum (ER) functions, including the misfolded protein catabolic process, protein glycosylation, and ER protein quality control.