SDHB Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SDHB Recombinant monoclonal antibody (87791-1-RR)

• 

  WB analysis using 87791-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87791-1-RR (SDHB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 87791-1-RR

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 87791-1-RR (SDHB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 87791-1-RR

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 87791-1-RR (SDHB antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SDHB Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87791-1-RR

Clone No.253361D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

EC:1.3.5.1, Iron-sulfur subunit of complex II, PGL 4, PGL4, SDH

---

Tested Applications

• Positive WB detected in: HepG2 cells, HSC-T6 cells, HeLa cells, HEK-293 cells, K-562 cells, NIH/3T3 cells, Neuro-2a cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87791-1-RR targets SDHB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0968

  Product name: Recombinant human SDHB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-280 aa of BC007840

  Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

• Full Name: succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 28-32 kDa
• GenBank Accession Number: BC007840
• Gene Symbol: SDHB
• Gene ID (NCBI): 6390
• RRID: AB_3745752
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21912
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS).