SDHC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SDHC Polyclonal antibody, PBS Only (14575-1-PBS)

• 

  WB analysis using 14575-1-AP (same clone as 14575-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14575-1-AP (SDHC antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14575-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14575-1-AP (same clone as 14575-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14575-1-AP (SDHC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14575-1-AP (same clone as 14575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14575-1-AP (SDHC antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 14575-1-AP (same clone as 14575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14575-1-AP (SDHC antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14575-1-PBS in a different storage buffer formulation.

SDHC Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14575-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

14575-1-PBS targets SDHC in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5775

  Product name: Recombinant human SDHC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-169 aa of BC033626

  Sequence: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM

• Full Name: succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC033626
• Gene Symbol: SDHC
• Gene ID (NCBI): 6391
• RRID: AB_2183291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99643
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SDHC(Succinate dehydrogenase cytochrome b560 subunit, mitochondrial) is also named as CYB560, SDH3 and belongs to the cytochrome b560 family. It is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Defects in SDHC are the cause of paragangliomas type 3 (PGL3) and paraganglioma and gastric stromal sarcoma (PGGSS). It has a transit peptide of 29 amino acid and has 5 isoforms produced by alternative splicing.