CoraLite® Plus 488-conjugated SEC13 Recombinant monoclonal antibody

SEC13 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85110-4
Clone No.242775C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

242775C3, D3S1231E, GATOR2 complex protein SEC13, Protein SEC13 homolog, SEC13A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85110-4 targets SEC13 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7610

Product name: Recombinant human SEC13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-325 aa of BC002634

Sequence: MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ

Predict reactive species
Full Name SEC13 homolog (S. cerevisiae)
Calculated Molecular Weight 36 kDa
Observed Molecular Weight36 kDa
GenBank Accession NumberBC002634
Gene Symbol SEC13
Gene ID (NCBI) 6396
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55735
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SEC13 is a component of the nuclear pore complex (NPC) and the COPII coat. It is required for esicle biogenesis from endoplasmic reticulum during the transport of proteins. Shuttling of SEC13 between the nucleus and the cytoplasm may couple and regulate functions between these two compartments. (PMID: 14517296; 16407955)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SEC13 antibody CL488-85110-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...