SEC16A Polyclonal antibody

• 

  WB analysis using 29417-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29417-1-AP (SEC16A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29417-1-AP

  Various lysates were subjected to Tris-acetate gel system followed by western blot with 29417-1-AP (SEC16A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse pancreas using 29417-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 29417-1-AP (SEC16A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 29417-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SEC16A antibody (29417-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  FC experiment of HeLa using 29417-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human SEC16A (29417-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

SEC16A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 29417-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

KIAA0310, p250, RP11 413M3.10, SEC16, SEC16 homolog A

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells
• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29417-1-AP targets SEC16A in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30700

  Product name: Recombinant human SEC16A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 550-722 aa of NM_014866

  Sequence: EVGKPEDEASGSFFKQIDSSPVGGETDETTVSQNYRGSVSQPSTPSPPKPTGIFQTSANSSFEPVKSHLVGVKPFEADRANVVGEVRETCVRQKQCRPAAALPDASPGNLEQPPDNMETLCAPQVCPLPLNSTTEAVHMLPHAGAPPLDTVYPAPEKRPSARTQGPVKCESPA

• Full Name: SEC16 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 252 kDa
• Observed Molecular Weight: 250-300 kDa
• GenBank Accession Number: NM_014866
• Gene Symbol: SEC16A
• Gene ID (NCBI): 9919
• RRID: AB_3086130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15027
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEC16A, also named as KIAA0310, SEC16 and SEC16L, is required for secretory cargo trafic from the endoplasmic reticulum to the Golgi apparatus. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining an ERES. SEC16A is required for normal transitional endoplasmic reticulum (tER) organization.