SEC22A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEC22A Polyclonal antibody, PBS Only (29179-1-PBS)

• 

  WB analysis using 29179-1-AP (same clone as 29179-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29179-1-AP (SEC22A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29179-1-PBS in a different storage buffer formulation.

SEC22A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29179-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

SEC22L2

---

Product Information

29179-1-PBS targets SEC22A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30293

  Product name: Recombinant human SEC22A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-187 aa of BC007122

  Sequence: YEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEP

• Full Name: SEC22 vesicle trafficking protein homolog A (S. cerevisiae)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC007122
• Gene Symbol: SEC22A
• Gene ID (NCBI): 26984
• RRID: AB_3742305
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96IW7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.