SEC22C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEC22C Polyclonal antibody, PBS Only (28078-1-PBS)

• 

  WB analysis using 28078-1-AP (same clone as 28078-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 28078-1-AP (SEC22C antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28078-1-AP (same clone as 28078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28078-1-AP (SEC22C antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 28078-1-AP (same clone as 28078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 28078-1-AP (SEC22C antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28078-1-PBS in a different storage buffer formulation.

SEC22C Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28078-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28078-1-PBS targets SEC22C in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27896

  Product name: Recombinant human SEC22C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-162 aa of BC018437

  Sequence: TDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVAN

• Full Name: SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC018437
• Gene Symbol: SEC22C
• Gene ID (NCBI): 9117
• RRID: AB_2881053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRL7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.