SEC23A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEC23A Polyclonal antibody, PBS Only (30465-1-PBS)

• 

  WB analysis using 30465-1-AP (same clone as 30465-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30465-1-AP (SEC23A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30465-1-PBS in a different storage buffer formulation.

SEC23A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30465-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CLSD, SEC23 related protein A

---

Product Information

30465-1-PBS targets SEC23A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33185

  Product name: Recombinant human SEC23A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 660-765 aa of BC036649

  Sequence: HGETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLSKVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA

• Full Name: Sec23 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC036649
• Gene Symbol: SEC23A
• Gene ID (NCBI): 10484
• RRID: AB_3742345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15436
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.