SEC23IP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEC23IP Polyclonal antibody, PBS Only (20892-1-PBS)

• 

  WB analysis using 20892-1-AP (same clone as 20892-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20892-1-AP (SEC23IP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20892-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 20892-1-AP (same clone as 20892-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 20892-1-AP (SEC23IP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20892-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 20892-1-AP (same clone as 20892-1-PBS)

  IP result of anti-SEC23IP (IP:20892-1-AP, 4ug; Detection:20892-1-AP 1:1000) with HeLa cells lysate 3600ug. This data was developed using the same antibody clone with 20892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20892-1-AP (same clone as 20892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20892-1-AP (SEC23IP antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20892-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 20892-1-AP (same clone as 20892-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20892-1-AP (SEC23IP antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20892-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 20892-1-AP (same clone as 20892-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SEC23IP antibody (20892-1-AP) at dilution of 1:0 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20892-1-PBS in a different storage buffer formulation.

SEC23IP Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 20892-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

MSTP053, p125, SEC23-interacting protein

---

Product Information

20892-1-PBS targets SEC23IP in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14916

  Product name: Recombinant human SEC23IP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 651-1000 aa of BC063800

  Sequence: ETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH

• Full Name: SEC23 interacting protein
• Calculated Molecular Weight: 1000 aa, 111 kDa
• Observed Molecular Weight: 125 kDa
• GenBank Accession Number: BC063800
• Gene Symbol: SEC23IP
• Gene ID (NCBI): 11196
• RRID: AB_10896458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6Y8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SEC23-interacting protein (SEC23IP), also known as p125, is a member of the phosphatidic acid preferring-phospholipase A1 family. SEC23IP interacts with Sec23, a coat component of COPII vesicles which are involved in protein export from the endoplasmic reticulum (ER). SEC23IP localizes to ER exit sites and participates in the organization of this compartment (PMID: 15623529). It may have a role in the early stage of the secretory pathway (PMID: 10400679).