SEC24B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SEC24B Polyclonal antibody (32225-1-AP)

• 

  WB analysis using 32225-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32225-1-AP (SEC24B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

SEC24B Polyclonal Antibody for WB, ELISA

Cat No. 32225-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

SEC24-related protein B, Protein transport protein Sec24B

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32225-1-AP targets SEC24B in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36544

  Product name: Recombinant human SEC24B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-250 aa of NM_006323.4

  Sequence: QNVTPNTVNQQPGAQQLYSRGPPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPLPPLPSQQHHQ

• Full Name: SEC24 family, member B (S. cerevisiae)
• Calculated Molecular Weight: 137kDa，1268aa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: NM_006323.4
• Gene Symbol: SEC24B
• Gene ID (NCBI): 10427
• RRID: AB_3742547
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95487
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SEC24B is a gene that encodes a protein belonging to the SEC23/SEC24 family, which is involved in vesicle trafficking. The protein is thought to be a cargo-binding component of the COPII vesicle and is involved in the transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.