CoraLite® Plus 488-conjugated SEC31A Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-84942-4

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 SEC31A antibody (CL488-84942-4, Clone: 242531E2 ) at dilution of 1:200, CL594-Phalloidin (red).

SEC31A Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84942-4

Clone No.242531E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

242531E2, ABP125, ABP130, KIAA0905, SEC31 like protein 1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84942-4 targets SEC31A in applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12314

  Product name: Recombinant human SEC31A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 758-1106 aa of BC084583

  Sequence: AAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV

• Full Name: SEC31 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 1220 aa, 133 kDa
• Observed Molecular Weight: 118-140 kDa
• GenBank Accession Number: BC084583
• Gene Symbol: SEC31A
• Gene ID (NCBI): 22872
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O94979
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

COPII-coated vesicles mediate anterograde transport from the ER to the Golgi apparatus. COPII is composed of three parts: two coat protein complexes (Sec23/24 complex and Sec13/31 complex) and one small GTP-binding protein, Sar1 (PMID: 9568718). The sec31 subunit of the coat complex has been shown to be essential for vesicle formation and ER-Golgi transport (PMID: 10788476). Two mammalian homologs of yeast sec31p, Sec31A and Sec31B, share about 40% amino acid identity. Sec31A transcripts are ubiquitously and abundantly expressed.