SEC61G Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SEC61G Polyclonal antibody, PBS Only (11147-2-PBS)

• 

  WB analysis of HEK-293 using 11147-2-AP (same clone as 11147-2-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11147-2-AP (SEC61G antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11147-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 11147-2-AP (same clone as 11147-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11147-2-AP (SEC61G antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11147-2-PBS in a different storage buffer formulation.

• 

  WB analysis of DC2.4 using 11147-2-AP (same clone as 11147-2-PBS)

  DC2.4 cells were subjected to SDS PAGE followed by western blot with 11147-2-AP (SEC61G antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11147-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11147-2-AP (same clone as 11147-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11147-2-AP (SEC61G antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11147-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SEC61G Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11147-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11147-2-PBS targets SEC61G in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1624

  Product name: Recombinant human SEC61G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC009480

  Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

• Full Name: Sec61 gamma subunit
• Calculated Molecular Weight: 7.7 kDa
• Observed Molecular Weight: 7.7 kDa
• GenBank Accession Number: BC009480
• Gene Symbol: SEC61G
• Gene ID (NCBI): 23480
• RRID: AB_2254450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P60059
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SEC61G is a subunit of the SEC61 complex, which also contains alpha (SEC61A) and beta (SEC61B) subunits. The SEC61 complex is the central component of the protein translocation apparatus on the endoplasmic reticulum membrane. The gene of SEC61G maps to chromosome 7p11.2, and encodes a 68-amino acid single-pass membrane protein. This antibody can recognize endogenous SEC61G that migrates at a molecular mass of ~8 kDa.