SEC62 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SEC62 Recombinant monoclonal antibody, PBS Only (87925-1-PBS)

• 

  WB analysis using 87925-1-RR (same clone as 87925-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87925-1-RR (SEC62 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87925-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 87925-1-RR (same clone as 87925-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SEC62 antibody (87925-1-RR, Clone: 253590D1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87925-1-PBS in a different storage buffer formulation.

SEC62 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87925-1-PBS

Clone No.253590D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Translocation protein SEC62, hTP-1, SEC 62, TP-1, Translocation protein 1

---

Product Information

87925-1-PBS targets SEC62 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29932

  Product name: Recombinant human SEC62 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of NM_003262

  Sequence: MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNE

• Full Name: SEC62 homolog (S. cerevisiae)
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_003262
• Gene Symbol: SEC62
• Gene ID (NCBI): 7095
• RRID: AB_3745830
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99442
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SEC62 is an integral endoplasmic reticulum (ER) membrane protein. SEC62 and SEC63 form a dimeric complex and play a central role in the translocation of nascent and newly synthesized precursor polypeptides into the ER. SEC62 is associated with poor prognosis in a variety of tumors, such as prostate cancer, hepatocellular cancer, breast cancer, melanoma, and colorectal cancer (PMID: 36262254).